The short version of Degree of hydrolysis fits in a sentence. The long version — which is the one that helps — is below.
Reviewed 2026-03-29. Anything still debated is marked as such rather than presented as settled.
Enzyme choice influences the peptide size distribution and the resulting functional properties. Some proteases cut at specific amino acid residues, while others act more broadly, so two hydrolysates with the same degree of hydrolysis can differ in peptide sequences. Short peptides are generally more water-soluble and less likely to form gels under heat, although bitterness can increase when hydrophobic residues become exposed. The relationship between peptide length, taste, and bioactivity is an active area of study, and not all proposed effects are established in human trials.
Composition tables often report protein content on a dry basis, ash, moisture, fat, and lactose. Because hydrolysis adds water to peptide bonds, the total mass yield can appear slightly higher than the original protein if residual salts and water are counted. Some products are further processed by ultrafiltration, spray drying, or decolorization, which alters mineral content and flavor. Product labels may distinguish partially hydrolyzed from extensively hydrolyzed whey, but these terms are not always defined by a single numerical threshold across regions.
Whey protein hydrolysate is a dairy ingredient made by treating whey protein with proteases that cleave peptide bonds. The starting material is typically whey protein concentrate or isolate, which contains beta-lactoglobulin, alpha-lactalbumin, and smaller amounts of bovine serum albumin and immunoglobulins. Hydrolysis shortens protein chains into peptides and free amino acids, changing solubility, viscosity, and flavor compared with intact whey protein. The extent of cleavage is commonly described by degree of hydrolysis, a percentage of broken peptide bonds relative to total bonds.
Whey protein hydrolysate is a dairy ingredient made by breaking peptide bonds in whey proteins. Enzymes such as proteases, or in some processes acid or heat, cleave the protein chains into shorter peptides and free amino acids. The starting material may be sweet whey, acid whey, whey protein concentrate, or whey protein isolate. Because raw materials and reaction conditions differ, the final mixture is not a single uniform substance. Its peptide profile, mineral content, and residual lactose depend on the source and the processing steps used.
Production typically begins with pasteurization and concentration of whey. A protease is added under controlled temperature and pH, and the reaction is stopped by heat or pH change when the target extent of cleavage is reached. Ultrafiltration or diafiltration may remove enzymes, salts, and small molecules. The liquid is then spray dried into a powder. Process parameters shape bitterness, solubility, and peptide size. Established control points include enzyme type, reaction time, and inactivation conditions. How these variables interact across large-scale batches remains an area of active process development.
Hydrolysates usually contain 70% to 90% protein on a dry basis, with variable ash, fat, and carbohydrate. Solubility in water is generally high over a broad pH range, though bitter notes can appear from exposed hydrophobic peptides. The powder tends to absorb moisture and may brown during prolonged warm storage. Applications span sports nutrition, clinical nutrition, infant formulas, and flavor systems. Regulatory status and labeling rules differ by country. A key open question is whether a given peptide profile reliably predicts functional or sensory behavior across different food matrices.
| Property | Value | Notes |
|---|---|---|
| Appearance | Off-white to pale yellow powder | Color varies with hydrolysis and drying |
| Solubility class | Highly soluble in water | Short peptides often dissolve more readily than intact protein |
| Typical protein content | 70-90% dry basis | Depends on starting material and purification |
| Degree of hydrolysis | 2-30% commonly reported | Method and calculation vary |
| Common synonyms | Hydrolyzed whey protein; whey protein hydrolysate | Labels may use either order |
Whey protein hydrolysate is made by cleaving peptide bonds in whey proteins. The starting material is usually whey protein concentrate or isolate obtained during cheese or casein production. Proteolytic enzymes, acid, or heat can drive hydrolysis, although commercial processes favor controlled enzymatic treatment. The degree of hydrolysis describes the proportion of peptide bonds broken and separates partial from extensive hydrolysates. The resulting powder contains short peptides, free amino acids, residual intact protein, minerals, lactose, and fat in proportions that depend on the starting whey and downstream filtration.
Molecular weight distribution is a central compositional feature, and hydrolysis shifts the population toward lower-mass peptides, often below ten kilodaltons in extensively treated products. Enzyme choice, reaction time, temperature, pH, and enzyme-to-substrate ratio influence the peptide profile. Ultrafiltration or diafiltration may remove enzymes, salts, and smaller molecules. Because peptide size affects solubility, taste, foaming, and digestibility, manufacturers specify molecular weight ranges. However, two hydrolysates with similar average molecular weight can differ in peptide sequence and functional behavior.
Bitterness often increases with hydrolysis because hydrophobic peptides are exposed. Processing strategies therefore include selecting enzymes that cleave at specific sites, using exopeptidases to remove terminal hydrophobic residues, or blending hydrolysates with other ingredients. Allergenicity is another consideration: extensive hydrolysis can reduce IgE-binding epitopes, but it does not guarantee absence of allergenic potential. Regulatory frameworks vary in how they classify hydrolyzed whey for infant formula or sports products. Claims about reduced allergenicity or faster absorption depend on the specific product and study design, and are not uniform across all hydrolysates.
Enzymatic hydrolysis usually uses proteases from microbial, plant, or animal sources. The enzyme choice, pH, temperature, and reaction time determine which peptide bonds are cleaved and the final peptide profile. After hydrolysis, the enzyme is inactivated by heat, and the mixture is clarified, filtered, concentrated, and spray-dried. Manufacturers may use ultrafiltration to remove larger peptides or minerals. The degree of hydrolysis, often reported as a percentage, describes the proportion of peptide bonds broken. A higher degree generally means shorter peptides, but it does not by itself define taste, allergenicity, or biological activity.
Whey protein hydrolysate appears in foods, infant formula, sports nutrition, and specialized clinical nutrition. Its production can reduce viscosity and improve heat stability compared with intact whey protein. Bitterness is common because short hydrophobic peptides can activate bitter taste receptors. The ingredient is not the same as free amino acids; it remains a mixture of peptides of different lengths. Composition varies by supplier, enzyme, and process, so two hydrolysates with the same protein content may behave differently in a formulation.
Composition reflects both the original whey and the hydrolysis process. Products contain protein-derived peptides, variable ash, moisture, and residual lactose or fat depending on filtration. Some free amino acids increase during hydrolysis, and bitterness often rises with higher degrees of hydrolysis due to exposed hydrophobic residues. Mineral profiles vary with the whey source and any neutralization step. Allergenicity may be reduced in extensively hydrolyzed products, but the extent depends on residual intact protein and peptide size, and this remains a subject of ongoing study.
Whey protein hydrolysate is a dairy-derived ingredient made by treating whey protein with enzymes or acid to break peptide bonds. The starting material is typically sweet whey or acid whey from cheese manufacture, which contains beta-lactoglobulin, alpha-lactalbumin, bovine serum albumin, and immunoglobulins. Hydrolysis shortens protein chains into peptides and free amino acids, changing solubility, viscosity, and taste. The extent of breakdown is described by degree of hydrolysis, a percentage of cleaved peptide bonds. This value influences functional and sensory properties but does not by itself define a specific molecular profile.
Commercial production usually begins with whey protein concentrate or isolate, not raw whey, to reduce fat and lactose. Food-grade proteases from bacterial or plant sources are added under controlled temperature and pH, then inactivated by heat or pH adjustment. The resulting liquid may be clarified, filtered, concentrated, and spray-dried into powder. Enzyme choice, reaction time, and pretreatment conditions create products with different peptide size distributions. Because these variables are proprietary and not standardized, two hydrolysates with the same degree of hydrolysis can differ in peptide sequences and mineral content.
== Chemistry == Bulevirtide is a 47-amino acid long lipopeptide with the following sequence: CH3(CH2)12CO-Gly-Thr-Asn-Leu-Ser-Val-Pro-Asn-Pro-Leu-Gly-Phe-Phe-Pro-Asp-His-Gln-Leu-Asp-Pro-Ala-Phe-Gly-Ala-Asn-Ser-Asn-Asn-Pro-Asp-Trp-Asp-Phe-Asn-Pro-Asn-Lys-Asp-His-Trp-Pro-Glu-Ala-Asn-Lys-Val-Gly-NH2 (C13H27CO-GTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANKVG-NH2)
==== Organ development ==== Since serotonin signals resource availability it is not surprising that it affects organ development. Many human and animal studies have shown that nutrition in early life can influence, in adulthood, such things as body fatness, blood lipids, blood pressure, atherosclerosis, behavior, learning, and longevity. Rodent experiment shows that neonatal exposure to SSRIs makes persistent changes in the serotonergic transmission of the brain resulting in behavioral changes, which are reversed by treatment with antidepressants. By treating normal and knockout mice lacking the serotonin transporter with fluoxetine scientists showed that normal emotional reactions in adulthood, like a short latency to escape foot shocks and inclination to explore new environments were dependent on active serotonin transporters during the neonatal period. Human serotonin can also act as a growth factor directly. Liver damage increases cellular expression of 5-HT2A and 5-HT2B receptors, mediating liver compensatory regrowth (see Liver § Liver regeneration) Serotonin present in the blood then stimulates cellular growth to repair liver damage. 5-HT2B receptors also activate osteocytes, which build up bone. However, serotonin also inhibits osteoblasts, through 5-HT1B receptors.
=== Venom === Although these spiders are capable of hunting and killing some of the most venomous spiders in the world such as the redback spider, they are not dangerous to humans. According to researchers Greta Binford and Pamela Zobel-Thropp, the effects of P. phalangioides venom on humans and other mammals are negligible. In humans, the P. phalangioides bite simply results in a mild stinging sensation that has no long-term health consequences.
Sources: en.wikipedia.org
Research in mice has shown that beta cells can often regenerate to the original quantity number after the beta cells have undergone some sort of stress test, such as the intentional destruction of the beta cells in the mice subject or once the auto-immune response has concluded. While these studies have conclusive results in mice, beta cells in human subjects may not possess this same level of versatility. Investigation of beta cells following acute onset of Type 1 diabetes has shown little to no proliferation of newly synthesized beta cells, suggesting that human beta cells might not be as versatile as rat beta cells, but there is actually no comparison that can be made here because healthy (non-diabetic) rats were used to prove that beta cells can proliferate after intentional destruction of beta cells, while diseased (type-1 diabetic) humans were used in the study which was attempted to use as evidence against beta cells regenerating. It appears that much work has to be done in the field of regenerating beta cells. Just as in the discovery of creating insulin through the use of recombinant DNA, the ability to artificially create stem cells that would differentiate into beta cells would prove to be an invaluable resource to patients with Type 1 diabetes. An unlimited amount of beta cells produced artificially could potentially provide therapy to many of the patients who are affected by Type 1 diabetes.
=== Val66Met === A common SNP in the BDNF gene is rs6265. This point mutation in the coding sequence, a guanine to adenine switch at position 196, results in an amino acid switch: valine to methionine exchange at codon 66, Val66Met, which is in the prodomain of BDNF. Val66Met is unique to humans. The mutation interferes with normal translation and intracellular trafficking of BDNF mRNA, as it destabilizes the mRNA and renders it prone to degradation. The proteins resulting from mRNA that does get translated, are not trafficked and secreted normally, as the amino acid change occurs on the portion of the prodomain where sortilin binds; and sortilin is essential for normal trafficking. The Val66Met mutation results in a reduction of hippocampal tissue and has since been reported in a high number of individuals with learning and memory disorders, anxiety disorders, major depression, and neurodegenerative diseases such as Alzheimer's and Parkinson's. A meta-analysis indicates that the BDNF Val66Met variant is not associated with serum BDNF.
== Side effects == 5-ARIs are generally well tolerated in both men and women and produce few side effects. However, they have been found to have some risks in studies with men, including slightly increased risks of decreased libido, erectile dysfunction, ejaculatory dysfunction, infertility, breast tenderness, gynecomastia, depression, anxiety, self-harm, and dementia. In addition, although 5-ARIs decrease the overall risk of developing prostate cancer, they have been found to increase the risk of developing certain rare but high-grade forms of prostate cancer. As a result, the FDA has notified healthcare professionals that the Warnings and Precautions section of the labels for the 5-ARI class of drugs has been revised to include new safety information about the increased risk of being diagnosed with these rare but more serious forms of prostate cancer. Finasteride has also been associated with intraoperative floppy iris syndrome and cataract formation. Depressive symptoms and suicidality have been reported.
Sources: en.wikipedia.org
Adolescent medicine Adult congenital heart disease Advanced heart failure and transplant cardiology Cardiovascular disease, dealing with disorders of the heart and blood vessels* Clinical cardiac electrophysiology Critical care medicine, is dealing with life-threatening conditions requiring intensive monitoring and treatment. Endocrinology, diabetes & metabolism, dealing with disorders of the endocrine system and its specific secretions called hormones Gastroenterology, concerned with the field of digestive diseases Geriatric medicine Hematology, concerned with blood, the blood-forming organs and its disorders. Hospice & palliative medicine Infectious disease, concerned with disease caused by a biological agent such as by a virus, bacterium or parasite Interventional cardiology Medical oncology, dealing with the chemotherapeutic (chemical) and/or immunotherapeutic (immunological) treatment of cancer Nephrology, dealing with the study of the function and diseases of the kidney Neurocritical care Pulmonary disease, dealing with diseases of the lungs and the respiratory tract Rheumatology, devoted to the diagnosis and therapy of rheumatic diseases Sleep medicine Sports medicine Transplant hepatology
A series of four lectures, given by Thomson on a visit to Princeton University in 1896, were subsequently published as Discharge of electricity through gases (1897). He also presented a series of six lectures at Yale University in 1904.
== Pull down time == The pull down time is defined as the necessary time to cool down the ULT freezer from ambient temperatures to the selected temperature of −80 to −86 °C (−112 to −123 °F). The time strongly depends on the type of insulation, the efficiency of the compressor system as well as the installed metal shelves within the freezer. At the start of the twenty-first century, ULT freezers were able to cool down within 3 to 5 hours. Warm up time is typically 1/8 °C per minute.
Burmese tofu (to hpu in Burmese) is a legume product made from besan (chana dal) flour; the Shan variety uses yellow split pea flour instead. Both types are yellow in color and generally found only in Myanmar, and Yunnan province of China, though the Burman variety is also available in some overseas restaurants serving Burmese cuisine. The term is believed to be derived from Dou Fen (bean Jelly) from Chinese and it was adopted to Burmese cuisine through Shan people (Dai people of Yunnan) . Burmese tofu may be fried as fritters cut into rectangular or triangular shapes. A variety called hsan to hpu (or hsan ta hpo in Shan regions) is made from rice flour (called hsan hmont or mont hmont) and is white in color with the same consistency as yellow Burmese tofu when set. It is eaten as a salad in the same manner as yellow tofu.
Sources: en.wikipedia.org
Hydrolysate has undergone enzymatic cleavage of peptide bonds, while isolate is largely intact protein. Both can originate from the same whey stream, but hydrolysis changes peptide size, solubility, taste, and allergenicity testing outcomes. The two ingredients are not interchangeable in every formulation.
No. A higher degree of hydrolysis means more peptide bonds have been broken, which can increase solubility and reduce viscosity but also raise bitterness and processing cost. The best degree depends on the intended use, such as a beverage, bar, or culture medium.
No. They differ by starting whey material, enzyme type, hydrolysis conditions, and downstream purification. These variables produce different peptide profiles, mineral contents, and functional properties. Two products with the same label category may therefore behave differently.
Hydrolysis extent indicates the share of peptide bonds that have been cleaved. It is often estimated from free amino groups and is reported as a percentage. A higher value means smaller peptides and more free amino acids, but it does not by itself define product quality.